PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00373.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 337aa    MW: 38490.5 Da    PI: 6.3517
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00373.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-55211481129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              +ppGfrFhPtdeel+++yLk+kv ++++++  ++ e+d++k+ePwdL+k++k ++ke+yfF++rd+ky+tg r+nrat+sgyWkat
  Rsa1.0_00373.1_g00006.1  21 MPPGFRFHPTDEELITCYLKEKVLDSRFTA-VAMGEADLNKCEPWDLQKRAKMGDKELYFFCQRDRKYPTGLRTNRATESGYWKAT 105
                              79*************************999.67***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ kg lvg+kktLvfy+grap+gekt+Wvmheyrle
  Rsa1.0_00373.1_g00006.1 106 GKDKEIFKGKGCLVGMKKTLVFYRGRAPRGEKTNWVMHEYRLE 148
                              ********9********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6218173IPR003441NAC domain
PROSITE profilePS5100557.1921172IPR003441NAC domain
PfamPF023651.7E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAVVVEEEVV LNHGGEELVD MPPGFRFHPT DEELITCYLK EKVLDSRFTA VAMGEADLNK  60
CEPWDLQKRA KMGDKELYFF CQRDRKYPTG LRTNRATESG YWKATGKDKE IFKGKGCLVG  120
MKKTLVFYRG RAPRGEKTNW VMHEYRLEGK YSYHNLPKSA RDEWVVCRVF HKNNPATTTQ  180
QMTRIPLEDL TRMDSLDNID HLLDFSSLPP LMDPSFTGQP EQHNFKSTSP PTYDILSSPI  240
QPRHFNSSYQ SIFDHQGFGS GSGSLYNNNS NKEMIKMEHS FVSVSQETCL SSDVNAATTT  300
EVSSVPAMKQ EMSMMGMMNG SKSYDDLCDL RGILWDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-49151749170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413570.0KP641357.1 Brassica napus NAC transcription factor 87.1 (NAC87.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120990.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ22e-95NC100_ARATH; NAC domain-containing protein 100
TrEMBLM4CD670.0M4CD67_BRARP; Uncharacterized protein
STRINGBra002148.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.10.0Arabidopsis NAC domain containing protein 87